Mathematics, 18.09.2019 17:30 sam1625

Halp me with this math plss
john drew a model car that was 7 inches long. the length of the actual car that the model is based on is 21 3/5 times the length of the model. what is the length, in feet, of the actual car?

Answers: 2

Show answers

Another question on Mathematics

Mathematics, 21.06.2019 18:00

Pat listed all the numbers that have 15 as a multiple write the numbers in pats list

Answers: 3

Answer

Mathematics, 21.06.2019 22:30

Select all of the following expressions that are equal to 2.5.

Answers: 3

Answer

Mathematics, 22.06.2019 01:00

Mr. t has been dating his girlfriend for one year nine months and six days how many hours has mr. t been in a relationship

Answers: 1

Answer

Mathematics, 22.06.2019 02:30

How many degrees are there in the central angles in a circle

Answers: 1

Answer

You know the right answer?

Halp me with this math plss
john drew a model car that was 7 inches long. the length of the a...

Questions

English, 14.12.2019 07:31

Choose one paragraph from the novel that uses a variety of clauses and phrases. identify and label at least three different kinds of clauses and phras...

Arts, 14.12.2019 07:31

Rate your favorite minecraft you tuberdantdmpewdiepielittlekellyminecraftpoofesuregrian

Health, 14.12.2019 07:31

Which of the following is an example of a processed food...

English, 14.12.2019 07:31

How did you do? were you able to determine the meanings of the words? use this method as you read anything-a book, a magazine, your schoolwork...

Mathematics, 14.12.2019 07:31

25 the graph represents the first three terms in an arithmetic sequence. a. find the explicit expression for this sequence b. find...

Mathematics, 14.12.2019 07:31

Find two consecutive positive integers such that the square of the smaller integer added to seven times the larger integer is equal to 85...

English, 14.12.2019 07:31

Hernandez, sylvester . "re: why does animal testing make me crazy? " animalrightsblog. animalforallblog. com, 29 sept. 2008. weba. it was...

Mathematics, 14.12.2019 07:31

The local business club has 240 members.its rules state that a two-thirds majority isneeded to amend the bylaws. a certainfaction ha...

Mathematics, 14.12.2019 07:31

If i have -2x and i have to divide it by itself do i divide by 2 or -2?...

Mathematics, 14.12.2019 07:31

The midpoint of mn is point p at (–4, 6). if point m is at (8, –2), what are the coordinates of point n?...

Chemistry, 14.12.2019 07:31

Describe the chemical reaction based on the chemical equation

Mathematics, 14.12.2019 07:31

The endpoints of rs are r(–5, 12) and s(4, –6). what are the coordinates of point t, which divides rs into a 4: 5 ratio?...

History, 14.12.2019 07:31

Im a complete paragragh explain how intrest in ancient text led to demands for church reform. at least three detauld ina well writyen paragraph about...

Computers and Technology, 14.12.2019 07:31

Which is an example of synchronous communication. text message e-mail voicemail telephone conversation...

English, 14.12.2019 07:31

Look at picture answer question which section of the article best explains the impacts of artificial trees on the christmas tree industry...

Mathematics, 14.12.2019 07:31

Jude says that the volume of a square pyramid with the base edges of 7 and height of 7 is equal to the volume of a cylinder with a radius of 7 and hei...

English, 14.12.2019 07:31

Why is it important to look at a larger societys needs instead of lookin at an individual's needs...

English, 14.12.2019 07:31

Why is it important to look at a larger societys needs instead of lookin at an individual's needs...

Mathematics, 14.12.2019 07:31

On a two-week job, a repairman works a total of 60 hours. he charges $80 plus $35 per hour. an equation shows this relationship, where x is the number...

Mathematics, 14.12.2019 07:31

determine whether the function below is an even function, an odd function, both, or neither. f(x) = (x + 5)2 a. both even and odd b....

More questions: Mathematics Another questions

Halp me with this math plss john drew a model car that was 7 inches long. the length of the actual car that the model is based on is 21 3/5 times the length of the model. what is the length, in feet, of the actual car?

Answers

Another question on Mathematics

Halp me with this math plss
john drew a model car that was 7 inches long. the length of the actual car that the model is based on is 21 3/5 times the length of the model. what is the length, in feet, of the actual car?