Biology, 24.08.2019 19:20 kev71

Which traits are characteristic of multicellular organisms?
choose all answers that are correct.
a.
different cells for different functions
b.
develop into specialized cells after they are formed
c.
all cells are smaller than those of single-celled organisms
d.
all cells are the same size and shape

Answers: 2

Show answers

Another question on Biology

Biology, 22.06.2019 00:00

Name the part of the the brain labeled "e".

Answers: 1

Answer

Biology, 22.06.2019 04:00

Cassandra made a venn diagram to compare and contrast the two stages of cellular respiration. which belongs in the area marked x? energy is released. oxygen is used up. glucose is broken down. carbon dioxide is used up.

Answers: 1

Answer

Biology, 22.06.2019 12:30

Development has provided electrically for less money but what may be considered a cause of nuclear power

Answers: 3

Answer

Biology, 22.06.2019 18:00

The most effective way to provide children with safety messages is to

Answers: 2

Answer

You know the right answer?

Which traits are characteristic of multicellular organisms?
choose all answers that are corre...

Questions

Social Studies, 14.12.2019 07:31

Which of the following was one way islam influenced the songhai empire?...

History, 14.12.2019 07:31

50 points // native american question which of the following statements about native warriors is incorrect? select the best answer...

Social Studies, 14.12.2019 07:31

Iwill mark as the brainliest answerplz put in order

Mathematics, 14.12.2019 07:31

25 the sequence 5, 20, 35, 50….. shows the number of sit-ups margie did each week, starting with her first week of the new year. (a) what...

English, 14.12.2019 07:31

Choose one paragraph from the novel that uses a variety of clauses and phrases. identify and label at least three different kinds of clauses and phras...

Arts, 14.12.2019 07:31

Rate your favorite minecraft you tuberdantdmpewdiepielittlekellyminecraftpoofesuregrian

Health, 14.12.2019 07:31

Which of the following is an example of a processed food...

English, 14.12.2019 07:31

How did you do? were you able to determine the meanings of the words? use this method as you read anything-a book, a magazine, your schoolwork...

Mathematics, 14.12.2019 07:31

25 the graph represents the first three terms in an arithmetic sequence. a. find the explicit expression for this sequence b. find...

Mathematics, 14.12.2019 07:31

Find two consecutive positive integers such that the square of the smaller integer added to seven times the larger integer is equal to 85...

English, 14.12.2019 07:31

Hernandez, sylvester . "re: why does animal testing make me crazy? " animalrightsblog. animalforallblog. com, 29 sept. 2008. weba. it was...

Mathematics, 14.12.2019 07:31

The local business club has 240 members.its rules state that a two-thirds majority isneeded to amend the bylaws. a certainfaction ha...

Mathematics, 14.12.2019 07:31

If i have -2x and i have to divide it by itself do i divide by 2 or -2?...

Mathematics, 14.12.2019 07:31

The midpoint of mn is point p at (–4, 6). if point m is at (8, –2), what are the coordinates of point n?...

Chemistry, 14.12.2019 07:31

Describe the chemical reaction based on the chemical equation

Mathematics, 14.12.2019 07:31

The endpoints of rs are r(–5, 12) and s(4, –6). what are the coordinates of point t, which divides rs into a 4: 5 ratio?...

History, 14.12.2019 07:31

Im a complete paragragh explain how intrest in ancient text led to demands for church reform. at least three detauld ina well writyen paragraph about...

Computers and Technology, 14.12.2019 07:31

Which is an example of synchronous communication. text message e-mail voicemail telephone conversation...

English, 14.12.2019 07:31

Look at picture answer question which section of the article best explains the impacts of artificial trees on the christmas tree industry...

Mathematics, 14.12.2019 07:31

Jude says that the volume of a square pyramid with the base edges of 7 and height of 7 is equal to the volume of a cylinder with a radius of 7 and hei...

More questions: Biology Another questions

Which traits are characteristic of multicellular organisms? choose all answers that are correct. a. different cells for different functions b. develop into specialized cells after they are formed c. all cells are smaller than those of single-celled organisms d. all cells are the same size and shape

Answers

Another question on Biology

Which traits are characteristic of multicellular organisms?
choose all answers that are correct.
a.
different cells for different functions
b.
develop into specialized cells after they are formed
c.
all cells are smaller than those of single-celled organisms
d.
all cells are the same size and shape