Spanish, 17.05.2021 21:30 BigGirlsTheBest

1. Una adaptación estructural que le permite a un
organismo confundirse con su entorno es

Answers: 2

Show answers

Another question on Spanish

Spanish, 23.06.2019 04:00

#1-20 ! worth 25 pts, teacher didn’t explain!

Answers: 1

Answer

Spanish, 23.06.2019 10:00

¿qué le encantaría estar haciendo al papá al comienzo del diálogo? estar en la playa estar empacando las maletas estar en el avión estar en la casa

Answers: 1

Answer

Spanish, 23.06.2019 22:30

There are groups of preterite verbs that do not follow the regular rules. the groups all have accents, and the groups do not have accents.

Answers: 1

Answer

Spanish, 24.06.2019 02:00

Marcia tiene un bolígrafo y una tarjeta. a. está leyendo. c. está escribiendo. b. está jugando. d. está comiendo.

Answers: 2

Answer

You know the right answer?

1. Una adaptación estructural que le permite a un
organismo confundirse con su entorno es...

Questions

Mathematics, 14.12.2019 07:31

Nikki gathered data about the length of time she spent listening to the radio and the number of commercials she heard. she organized the data in a sca...

Mathematics, 14.12.2019 07:31

Graph the system of equations on your graph paper to answer the question. {y=x−4 y=−x+6 what is the solution for this system...

Mathematics, 14.12.2019 07:31

(26 pts)write an equation of the line tangent to the graph off(x) = 3x^3 + 8x^2 at thepoint where x = -2.

Mathematics, 14.12.2019 07:31

The denarius was a unit of currency in ancient rome. suppose it costs the roman government 101010 denarius per day to support 333 legionaries and 333...

Mathematics, 14.12.2019 07:31

Me i don’t understand how i’m supposed t solve this

Chemistry, 14.12.2019 07:31

Aphase is a part of a system with what type of composition? gaseous liquid different uniform...

Mathematics, 14.12.2019 07:31

What is 30 x 25 + 30^7? (no calculator)...

Health, 14.12.2019 07:31

Doing homework need a anwser dont know it 2. in one sentence, explain the difference between an intentional and unintentional injury. the...

English, 14.12.2019 07:31

Manuel is writing an analysis paper on edgar allan poe's poem "the raven." which two of the following elements does he need to include in his essay?...

Mathematics, 14.12.2019 07:31

What is 1/5 3/7 2/7 5/8 4/5 as greatest to least...

History, 14.12.2019 07:31

50 points // native american questionthe tribal would observe the war games to determine the youths’ preparedness for real battle situati...

Social Studies, 14.12.2019 07:31

Which of the following was one way islam influenced the songhai empire?...

History, 14.12.2019 07:31

50 points // native american question which of the following statements about native warriors is incorrect? select the best answer...

Social Studies, 14.12.2019 07:31

Iwill mark as the brainliest answerplz put in order

Mathematics, 14.12.2019 07:31

25 the sequence 5, 20, 35, 50….. shows the number of sit-ups margie did each week, starting with her first week of the new year. (a) what...

English, 14.12.2019 07:31

Choose one paragraph from the novel that uses a variety of clauses and phrases. identify and label at least three different kinds of clauses and phras...

Arts, 14.12.2019 07:31

Rate your favorite minecraft you tuberdantdmpewdiepielittlekellyminecraftpoofesuregrian

Health, 14.12.2019 07:31

Which of the following is an example of a processed food...

English, 14.12.2019 07:31

How did you do? were you able to determine the meanings of the words? use this method as you read anything-a book, a magazine, your schoolwork...

Mathematics, 14.12.2019 07:31

25 the graph represents the first three terms in an arithmetic sequence. a. find the explicit expression for this sequence b. find...

More questions: Spanish Another questions

1. Una adaptación estructural que le permite a unorganismo confundirse con su entorno es​

Answers

Another question on Spanish

1. Una adaptación estructural que le permite a un
organismo confundirse con su entorno es